PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr030848.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 486aa    MW: 53438 Da    PI: 5.1269
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr030848.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.91.5e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT++Ede+l+ +++  G g+W++ ++  g+ R++k+c++rw +yl
      Pbr030848.1 14 KGRWTADEDEILLSYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding46.39.6e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E++ ++++++ lG++ W++Ia+ ++ gRt++++k++w+++l
      Pbr030848.1  67 RGNISSQEEDVIIKLHASLGNR-WSLIASQLP-GRTDNEIKNYWNSHL 112
                      78999*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-21564IPR009057Homeodomain-like
PROSITE profilePS5129415.93961IPR017930Myb domain
SuperFamilySSF466896.5E-2711108IPR009057Homeodomain-like
SMARTSM007172.1E-111363IPR001005SANT/Myb domain
PfamPF002498.1E-141461IPR001005SANT/Myb domain
CDDcd001677.02E-91661No hitNo description
PROSITE profilePS5129424.11162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.9E-2465116IPR009057Homeodomain-like
SMARTSM007173.4E-1466114IPR001005SANT/Myb domain
PfamPF002496.3E-1367112IPR001005SANT/Myb domain
CDDcd001671.33E-971112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MGRAPCCEKV GLKKGRWTAD EDEILLSYIQ ANGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRADLKRGNI SSQEEDVIIK LHASLGNRWS LIASQLPGRT DNEIKNYWNS HLSRKIDTFR  120
RHTTTIAITT EISTSSLPAG HEVSAAMELG PPPPKRRRGR TSRWAMKKNK TYLTTKHKGL  180
EARLSQSHHK DVDVSAADDD RLNNVHKATA LPTENNNKTV DTMQDDYVLR IEAPDQQQET  240
GGGGISMMAT VIDHQKESDG GKLILGPHPL VHDDGDMNES VGIDGGLLGF TDYLMDDINE  300
DEILDPNGVL ALSASEINIH QDADHFTDAD HHQDTELPSS CDQLVMCPNK IMMTTTNTTT  360
TAASDDHHDQ EQESRSCGGN LNSLSISNSN GQVVTGDLHS CGSSMSLTNA SNCDMEDGHT  420
AGGFGTHDHT LWDWESVLIQ ARTEHDYLWD GHDRQNMLSL LREGESATAA GDDDHADAMV  480
AWLLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-23121185110B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP9658030.0KP965803.1 Pyrus pyrifolia var. culta MYB12 (MYB12) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009339792.10.0PREDICTED: uncharacterized protein LOC103931986
TrEMBLA0A0N7EZN10.0A0A0N7EZN1_PYRPY; MYB12
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.14e-70myb domain protein 111